PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s1023091g001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family MYB
Protein Properties Length: 949aa    MW: 103701 Da    PI: 6.6192
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s1023091g001genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding262.1e-083879346
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                        +WT+eE e + +  + +G++ +++I++ +  ++t  +c+++++k
  PDK_30s1023091g001 38 PWTQEEKEVFMEMLATFGKD-FTKISSFFS-HKTTADCIEFYYK 79
                        8*****************99.*********.***********98 PP

2Myb_DNA-binding34.25.8e-11251290445
                         S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         WT eE   +++a  ++G++ +++I+r++g +R+++qck ++ 
  PDK_30s1023091g001 251 WTDEEKSMFIRALSMYGKD-FARISRRVG-TRSREQCKIFFS 290
                         *****************99.*********.********8775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.12E-142285IPR009057Homeodomain-like
PROSITE profilePS5129314.4853485IPR017884SANT domain
SMARTSM007171.2E-83583IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.9E-63782IPR009057Homeodomain-like
PfamPF002492.1E-63779IPR001005SANT/Myb domain
PROSITE profilePS5129314.281246297IPR017884SANT domain
SMARTSM007179.7E-9247295IPR001005SANT/Myb domain
SuperFamilySSF466894.76E-11250298IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.8E-7250291IPR009057Homeodomain-like
CDDcd001679.42E-9251289No hitNo description
PfamPF002491.2E-9251289IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 949 aa     Download sequence    Send to blast
MPALIFDEKE RKQTKFITSN RLIEDPISFE KERAMINPWT QEEKEVFMEM LATFGKDFTK  60
ISSFFSHKTT ADCIEFYYKN HKSESFKEVK KRLDLKKQWQ CLPTSNYLVT SGKKWNRGIN  120
AASLDMLGAA SMVAAHSSGN AKSQQRYAGR SIHGTYNGLK VPCGNYRSLE TVSSVEIPGH  180
ERETVAADVL AGMCGALSSE AMSSCVTSSI DPVEKMSFMA VERPLTLEVT QIFDEGTCSN  240
EGCGDLDSFD WTDEEKSMFI RALSMYGKDF ARISRRVGTR SREQCKIFFS KARKCLGLDV  300
IHQGISNGGM PMGDANGGRG DADDACAAEM DSAICSMQSC SKMDADVCQS VAKINSEGWV  360
NAAMTPLQAE TDRTSEQGVV GGINLEEEGK VDKHVSVLPE NKLVSEGDNP QSVFTLKKNA  420
DAAIRSNESV QLHEAVECVH AAMKIGGSMV SPVEPAFTAC MEVESKAHID DVVQQKGNGG  480
KFSADVMKKE VDVPLLVPET ESCNKQQMDI DLINGGKICS ASNSKVDLNS LLPGKKVDDC  540
PRSTFAPDCQ HQIHLDLLRC LQKIPQGISL KQENPDSLLL NSVLPDPSSI CFEGPHLVAS  600
QAMNFEEHGN KQHLNPAARD LYQQYMLRNP FLHLVDQPLH VLRGYPLQVK NQEVKREADP  660
LIGEKPVLIE SHPKKNGVSQ SNQFFTSEMH GDHCYRSSLS RSRPGVLFPL RSEAQPEAQL  720
RHCSQNACSE PEEQTHQASD VKLFGQIICH PSSSQKSNSS PHECNSKPSS PRINRSSTGK  780
PSNAVKAGMP FASTPGNSGH VGLEELPVRS YGFCDGNRLQ SGFSSLPESA VMLAKYHGSL  840
AGMSFYTAKD SVPSSNGILA QQSYMQHLAS DGKRLESFCE LQKRNGIEMV SGFQQQGRVA  900
RLGANMVGGG ILGSGGVSDP VAALKMHYAA RANVLSGEME SWRGDIGGR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C1e-15187994NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D1e-15187994NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008793426.10.0PREDICTED: uncharacterized protein LOC103709716 isoform X1
RefseqXP_008793431.10.0PREDICTED: uncharacterized protein LOC103709716 isoform X1
TrEMBLM0TC910.0M0TC91_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P32970_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-70MYB family protein